(data stored in ACNUC7421 zone)

EMBL: CP000821.PE491

CP000821.PE491       Location/Qualifiers
FT   CDS             604714..605553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0491"
FT                   /product="copper ABC transporter, permease protein"
FT                   /note="KEGG: slo:Shew_0357 copper ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35104"
FT                   /db_xref="GOA:A8FQI1"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQI1"
FT                   /protein_id="ABV35104.1"
FT                   /translation="MNRFTSPVLIIASKEICDSSRNRWLAFMGSIFLLLSLSVTFAGSA
FT                   VTGSLYLPELASLMSSLSTISVFIIPLAAILLSYDSFVGEDESGTLLLLLSYPLTRLQI
FT                   LCGKLLGHMTVMLLATSFAFGVTAILLLLIGEQYQVAELIGAFAQFLLSSNLLALTFIL
FT                   FSYIVSLKSTEKAKAVGTLLLVWFLFVLIYDLLLLTILVSDLSFANQYVVNILIALSPT
FT                   DLYRAINLMAIEGGDGRGSLAMLTETDWGLPGMYVLMLLWIALLSWISHGIFKRKRL"
     MNRFTSPVLI IASKEICDSS RNRWLAFMGS IFLLLSLSVT FAGSAVTGSL YLPELASLMS        60
     SLSTISVFII PLAAILLSYD SFVGEDESGT LLLLLSYPLT RLQILCGKLL GHMTVMLLAT       120
     SFAFGVTAIL LLLIGEQYQV AELIGAFAQF LLSSNLLALT FILFSYIVSL KSTEKAKAVG       180
     TLLLVWFLFV LIYDLLLLTI LVSDLSFANQ YVVNILIALS PTDLYRAINL MAIEGGDGRG       240
     SLAMLTETDW GLPGMYVLML LWIALLSWIS HGIFKRKRL                              279
//

If you have problems or comments...

PBIL Back to PBIL home page