(data stored in ACNUC7421 zone)

EMBL: CP000821.PE494

CP000821.PE494       Location/Qualifiers
FT   CDS             609839..610267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0494"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35107"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQI4"
FT                   /protein_id="ABV35107.1"
FT                   /translation="MKKALGQIVVSLTLLLSAATCFAGGGSDMAPAPHQDVQLNPISMT
FT                   EAETLVGKEGVYFFDVNTLELWAEGYIPGAIYFNVKDWKKLLPENKDTVMVFYCANRLC
FT                   NASEIAARAVMKLGYTGVRHMYDGIYGWRLANRVTEKP"
     MKKALGQIVV SLTLLLSAAT CFAGGGSDMA PAPHQDVQLN PISMTEAETL VGKEGVYFFD        60
     VNTLELWAEG YIPGAIYFNV KDWKKLLPEN KDTVMVFYCA NRLCNASEIA ARAVMKLGYT       120
     GVRHMYDGIY GWRLANRVTE KP                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page