(data stored in ACNUC7421 zone)

EMBL: CP000821.PE496

CP000821.PE496       Location/Qualifiers
FT   CDS             611182..611904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0496"
FT                   /product="tetratricopeptide TPR_2 repeat protein"
FT                   /note="KEGG: slo:Shew_0351 tetratricopeptide TPR_2 repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35109"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQI6"
FT                   /protein_id="ABV35109.1"
FT                   /translation="MNSLAIGIGVTLCAFIALIWRHHLRCLNQGVIHIAKQSNACDSEV
FT                   ITPSLDIKIPVLLSIVLLFSSVSLYSQLGHFSDWDKGSVDEHIDYLITADINKNAKTVN
FT                   EQPNNEIALLNLAQSYADGGLYSDSVKTFDELLQLTGDDAGILGMKANAMYYRDNRAMS
FT                   LDIDLVIARALAIDEYEFQSRLLLATHGYLNGNYEEAIKQWELLLKSDSQSFNRDSINN
FT                   AILRAEQKIANRSVTASE"
     MNSLAIGIGV TLCAFIALIW RHHLRCLNQG VIHIAKQSNA CDSEVITPSL DIKIPVLLSI        60
     VLLFSSVSLY SQLGHFSDWD KGSVDEHIDY LITADINKNA KTVNEQPNNE IALLNLAQSY       120
     ADGGLYSDSV KTFDELLQLT GDDAGILGMK ANAMYYRDNR AMSLDIDLVI ARALAIDEYE       180
     FQSRLLLATH GYLNGNYEEA IKQWELLLKS DSQSFNRDSI NNAILRAEQK IANRSVTASE       240
//

If you have problems or comments...

PBIL Back to PBIL home page