(data stored in ACNUC7421 zone)

EMBL: CP000821.PE499

CP000821.PE499       Location/Qualifiers
FT   CDS             613800..614288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0499"
FT                   /product="NosL protein"
FT                   /note="KEGG: son:SO0485 NosL protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35112"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQI9"
FT                   /protein_id="ABV35112.1"
FT                   /translation="MKKLILILLVIPVLFACSRGDAVTKSVEAQAIHDHERCHLCGMMI
FT                   TKYPGPKGQLQLKSEEIVPKFCSTRDMFNFSLQPENQRQITALMVHDMSATDWAHPDDK
FT                   HFIDATQAWYVYGTSRKAVMGPAVASFATEEGAVQFAKEFGGAVLGYEQITLELLLGE"
     MKKLILILLV IPVLFACSRG DAVTKSVEAQ AIHDHERCHL CGMMITKYPG PKGQLQLKSE        60
     EIVPKFCSTR DMFNFSLQPE NQRQITALMV HDMSATDWAH PDDKHFIDAT QAWYVYGTSR       120
     KAVMGPAVAS FATEEGAVQF AKEFGGAVLG YEQITLELLL GE                          162
//

If you have problems or comments...

PBIL Back to PBIL home page