(data stored in ACNUC7421 zone)

EMBL: CP000821.PE501

CP000821.PE501       Location/Qualifiers
FT   CDS             615611..616513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0501"
FT                   /product="ABC transporter-related protein"
FT                   /note="KEGG: slo:Shew_0356 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35114"
FT                   /db_xref="GOA:A8FQJ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQJ1"
FT                   /protein_id="ABV35114.1"
FT                   /translation="MNTAVSARNISHNFGADVALDDVSFEMKQGQTMALLGHNGAGKST
FT                   LIKILLGLITPTGGVINILGRNIRKNTSRSDLKLGYLPENVSFYDKLTGEEILTYFAEL
FT                   KGVGKNRVCELIEEFGLGYAKDRALKTYSKGMKQRLGFAQAILCEPELLLLDEPTVGLD
FT                   PVASQFLYGKIDELKRLGCAVIVCTHELSLIENNIDTALILGKGRCLASGNLGELRYES
FT                   RLKTRLTSPSLAALVNDSERLASLYTDNALLLDSESKQDVVQYLTAECGLFDFALKEPG
FT                   LAEIYHFHMQKYSQLGVVS"
     MNTAVSARNI SHNFGADVAL DDVSFEMKQG QTMALLGHNG AGKSTLIKIL LGLITPTGGV        60
     INILGRNIRK NTSRSDLKLG YLPENVSFYD KLTGEEILTY FAELKGVGKN RVCELIEEFG       120
     LGYAKDRALK TYSKGMKQRL GFAQAILCEP ELLLLDEPTV GLDPVASQFL YGKIDELKRL       180
     GCAVIVCTHE LSLIENNIDT ALILGKGRCL ASGNLGELRY ESRLKTRLTS PSLAALVNDS       240
     ERLASLYTDN ALLLDSESKQ DVVQYLTAEC GLFDFALKEP GLAEIYHFHM QKYSQLGVVS       300
//

If you have problems or comments...

PBIL Back to PBIL home page