(data stored in ACNUC7421 zone)

EMBL: CP000821.PE502

CP000821.PE502       Location/Qualifiers
FT   CDS             616515..617345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0502"
FT                   /product="copper ABC transporter, permease protein"
FT                   /note="KEGG: slo:Shew_0357 copper ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35115"
FT                   /db_xref="GOA:A8FQJ2"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQJ2"
FT                   /protein_id="ABV35115.1"
FT                   /translation="MLFHSSVLVIAKKEIRDSLRNRWVTFISLIFLLLSLSVTFAGSAV
FT                   VGQLALPKLDALISSLSTISVFIIPLAAMLVSYDAFIGEDESGTLLLLLSYPLSRFQIL
FT                   SGKLIGHSVIMSFTISFAFGLTAVLLLIFGDNYDVAATVGQFSQFILTSILLAITFILL
FT                   GYIVSLKATEKAKAVATVLFVWFLFVLIYDLLLLTLLVADISFFNQYIINVLIALNPTD
FT                   LYRAINLIGTDASKGSLATLSASGWGKIALYLVMGLWVSGLMLVANFVFKRRQL"
     MLFHSSVLVI AKKEIRDSLR NRWVTFISLI FLLLSLSVTF AGSAVVGQLA LPKLDALISS        60
     LSTISVFIIP LAAMLVSYDA FIGEDESGTL LLLLSYPLSR FQILSGKLIG HSVIMSFTIS       120
     FAFGLTAVLL LIFGDNYDVA ATVGQFSQFI LTSILLAITF ILLGYIVSLK ATEKAKAVAT       180
     VLFVWFLFVL IYDLLLLTLL VADISFFNQY IINVLIALNP TDLYRAINLI GTDASKGSLA       240
     TLSASGWGKI ALYLVMGLWV SGLMLVANFV FKRRQL                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page