(data stored in ACNUC7421 zone)

EMBL: CP000821.PE504

CP000821.PE504       Location/Qualifiers
FT   CDS             complement(619041..619751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0504"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="KEGG: sbl:Sbal_0464 oxidoreductase
FT                   FAD/NAD(P)-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35117"
FT                   /db_xref="GOA:A8FQJ4"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQJ4"
FT                   /protein_id="ABV35117.1"
FT                   /translation="MKTIRCKIEQVTPFNEAVYQIILKPETAFDFKAGQYLCVVMDEKD
FT                   KRPFSIASAPDAEHIELHIGAAVSESYPMQVVDRMQECLQNNATIEVEVPGGDAHLRHE
FT                   SQRPRLMIAGGTGFSYIKSIVEHQIALDLQVETTFYWGCRTQDAMYYETIAREWHDAHP
FT                   WMHFVPVLEQANDDWKGKQANLLDQIRTDFVSLNGYDIYIAGRFDMVGTARELFRTMGL
FT                   EEDHLYGDAFAFIK"
     MKTIRCKIEQ VTPFNEAVYQ IILKPETAFD FKAGQYLCVV MDEKDKRPFS IASAPDAEHI        60
     ELHIGAAVSE SYPMQVVDRM QECLQNNATI EVEVPGGDAH LRHESQRPRL MIAGGTGFSY       120
     IKSIVEHQIA LDLQVETTFY WGCRTQDAMY YETIAREWHD AHPWMHFVPV LEQANDDWKG       180
     KQANLLDQIR TDFVSLNGYD IYIAGRFDMV GTARELFRTM GLEEDHLYGD AFAFIK           236
//

If you have problems or comments...

PBIL Back to PBIL home page