(data stored in ACNUC7421 zone)

EMBL: CP000821.PE506

CP000821.PE506       Location/Qualifiers
FT   CDS             621781..622272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0506"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0361 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35119"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQJ6"
FT                   /protein_id="ABV35119.1"
FT                   /translation="MSQLSRVRRAVILCGLLSLSSLSAQASDRFNWSSNVWVQPTWSSS
FT                   WGHHYPNYNSGWRWGVGVSTGSPYWNNHGYYWNRPWYRPYWRNNWGYPYRYDRREYKRP
FT                   EPKVIAPPQRVTTSVQYASGLKSLPENARVMQRDGRTIYEWQGIEYVFDWSSETYRELR
FT                   "
     MSQLSRVRRA VILCGLLSLS SLSAQASDRF NWSSNVWVQP TWSSSWGHHY PNYNSGWRWG        60
     VGVSTGSPYW NNHGYYWNRP WYRPYWRNNW GYPYRYDRRE YKRPEPKVIA PPQRVTTSVQ       120
     YASGLKSLPE NARVMQRDGR TIYEWQGIEY VFDWSSETYR ELR                         163
//

If you have problems or comments...

PBIL Back to PBIL home page