(data stored in ACNUC7421 zone)

EMBL: CP000821.PE507

CP000821.PE507       Location/Qualifiers
FT   CDS             622689..622946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0507"
FT                   /product="toxin secretion, membrane fusion protein"
FT                   /note="KEGG: son:SO_A0050 toxin secretion, membrane fusion
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35120"
FT                   /db_xref="GOA:A8FQJ7"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQJ7"
FT                   /protein_id="ABV35120.1"
FT                   /translation="MTGIFRRQAVEAQKNKLHGDISLAQPLSIYSVVLALLAIVVATSI
FT                   FLSFSNYARKETVRGYIVPDKGVIKTHASRSGNVMLIILS"
     MTGIFRRQAV EAQKNKLHGD ISLAQPLSIY SVVLALLAIV VATSIFLSFS NYARKETVRG        60
     YIVPDKGVIK THASRSGNVM LIILS                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page