(data stored in ACNUC7421 zone)

EMBL: CP000821.PE508

CP000821.PE508       Location/Qualifiers
FT   CDS             623989..624969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0508"
FT                   /product="putative CheW protein"
FT                   /note="KEGG: sbl:Sbal_3194 putative CheW protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35121"
FT                   /db_xref="GOA:A8FQJ8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024181"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQJ8"
FT                   /protein_id="ABV35121.1"
FT                   /translation="MNDLKKSEILTESGTNELEIIEFHLHKLLPDGGFKVCHYGINVAK
FT                   VREVILVPSTSDYPNAQPHMVGVFSLRDILIPLVDLAGWLGIPTKDDLTHKVVIVTDFN
FT                   KMINGFLIDSVRSIHRVSWEQVESPSQFLEAGEQDCVVAVVRREGHLIMVLDFEKIIAD
FT                   INPELSMDKYDVLQDKSVIIDDTMLAKREAKTILVVDDSAFIRKMIENTLRSAGYNIIT
FT                   AKDGGDALEMLLEYERLAVDEGASVNDFVSAIITDVEMPRMDGMHLVKRLRDTSAYSNM
FT                   PIVMFSSLMSEDNRSKALQLGANDTITKPEIGRMVGMMDGYVLDD"
     MNDLKKSEIL TESGTNELEI IEFHLHKLLP DGGFKVCHYG INVAKVREVI LVPSTSDYPN        60
     AQPHMVGVFS LRDILIPLVD LAGWLGIPTK DDLTHKVVIV TDFNKMINGF LIDSVRSIHR       120
     VSWEQVESPS QFLEAGEQDC VVAVVRREGH LIMVLDFEKI IADINPELSM DKYDVLQDKS       180
     VIIDDTMLAK REAKTILVVD DSAFIRKMIE NTLRSAGYNI ITAKDGGDAL EMLLEYERLA       240
     VDEGASVNDF VSAIITDVEM PRMDGMHLVK RLRDTSAYSN MPIVMFSSLM SEDNRSKALQ       300
     LGANDTITKP EIGRMVGMMD GYVLDD                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page