(data stored in ACNUC7421 zone)

EMBL: CP000821.PE51

CP000821.PE51        Location/Qualifiers
FT   CDS             complement(63481..64203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0051"
FT                   /product="RNA polymerase, sigma 28 subunit, FliA/WhiG
FT                   family"
FT                   /note="KEGG: shw:Sputw3181_0490 RNA polymerase, sigma 28
FT                   subunit, FliA/WhiG family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34664"
FT                   /db_xref="GOA:A8FP91"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012845"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP91"
FT                   /protein_id="ABV34664.1"
FT                   /translation="MNSGQLAYQEASDEQVPNRLSENQVMSQYLPLVKRSISQLRSHCG
FT                   TVLAIEDMEQIGMMALLESSRRYPGEYDNGFISYAGQRIRGAILDELRRQDWRPRPVRQ
FT                   QAHELNDTVRKLTRLLGREPSDIEVAEAMGLNREEYRERLYASQSESMKSLDDMLSVGA
FT                   HFPDKTNVIEQFSVQKTLIKAISKLSKREQLILSLYYQHELNLKEIAGTLGLTETRICQ
FT                   LHKQAVKHLQEIYQQWER"
     MNSGQLAYQE ASDEQVPNRL SENQVMSQYL PLVKRSISQL RSHCGTVLAI EDMEQIGMMA        60
     LLESSRRYPG EYDNGFISYA GQRIRGAILD ELRRQDWRPR PVRQQAHELN DTVRKLTRLL       120
     GREPSDIEVA EAMGLNREEY RERLYASQSE SMKSLDDMLS VGAHFPDKTN VIEQFSVQKT       180
     LIKAISKLSK REQLILSLYY QHELNLKEIA GTLGLTETRI CQLHKQAVKH LQEIYQQWER       240
//

If you have problems or comments...

PBIL Back to PBIL home page