(data stored in ACNUC7421 zone)

EMBL: CP000821.PE511

CP000821.PE511       Location/Qualifiers
FT   CDS             627002..628204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0511"
FT                   /product="putative tyrosine-specific transport protein"
FT                   /note="KEGG: ppr:PBPRA2465 putative tyrosine-specific
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35124"
FT                   /db_xref="GOA:A8FQK1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR013059"
FT                   /db_xref="InterPro:IPR013061"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQK1"
FT                   /protein_id="ABV35124.1"
FT                   /translation="MNKSKIFGSMLIIAGTTIGAGMLALPLASSGLGFGVASIIMLLIW
FT                   SLMTYTALLMIEVHQFAPADATLHTLAYKLLGRKGQLIASFSMMFLFYALCAAYIAGGG
FT                   EQIHSKLTSWFELDIPMQLGAILFTVLIGTVVAIGTRSVDMINRSLFSLKLIALVLMLF
FT                   LLLPHVSVDNLVALPVHQGLVLASLPVIFTSFGFHGSIPSIVRYLGKDTKALRWIIVVG
FT                   SALPLAVYLLWMLASQGVLTQGDLMGSQSLNGFIGSLSRLLHDPMIANTVSIFADLALA
FT                   TSFLGVSLGLYDFIADLLKRSTKPSHRVQVALVTFMPPLGFAMFYPQGFIAALGYAAFA
FT                   LVVLAIFLPVAMVSTQRRQVGLGGYRVRGGALGLGLVTLAGILIMTVQLLQMFDALPAV
FT                   G"
     MNKSKIFGSM LIIAGTTIGA GMLALPLASS GLGFGVASII MLLIWSLMTY TALLMIEVHQ        60
     FAPADATLHT LAYKLLGRKG QLIASFSMMF LFYALCAAYI AGGGEQIHSK LTSWFELDIP       120
     MQLGAILFTV LIGTVVAIGT RSVDMINRSL FSLKLIALVL MLFLLLPHVS VDNLVALPVH       180
     QGLVLASLPV IFTSFGFHGS IPSIVRYLGK DTKALRWIIV VGSALPLAVY LLWMLASQGV       240
     LTQGDLMGSQ SLNGFIGSLS RLLHDPMIAN TVSIFADLAL ATSFLGVSLG LYDFIADLLK       300
     RSTKPSHRVQ VALVTFMPPL GFAMFYPQGF IAALGYAAFA LVVLAIFLPV AMVSTQRRQV       360
     GLGGYRVRGG ALGLGLVTLA GILIMTVQLL QMFDALPAVG                             400
//

If you have problems or comments...

PBIL Back to PBIL home page