(data stored in ACNUC7421 zone)

EMBL: CP000821.PE512

CP000821.PE512       Location/Qualifiers
FT   CDS             629048..629992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0512"
FT                   /product="transcriptional regulator-like protein"
FT                   /note="KEGG: saz:Sama_2899 transcriptional regulator-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35125"
FT                   /db_xref="GOA:A8FQK2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQK2"
FT                   /protein_id="ABV35125.1"
FT                   /translation="MKKIDHLDSFTLSVFVELYEQKSGTAAAAKLAITQSKVSRTLTSL
FT                   RHIFENELFIRQQHGMKPNHLADRLYPLAKTLVANYQSLAHTMEITVAENKAVNIAAQG
FT                   NFHNIIFDCLNQVTIGEGSPFSFELHTITSDFQKKLVNGVFDYCISINPAQADGITRYE
FT                   IGEIGRYFLVAKKGHPIFNSKITLENILKYKVAISNYALDEQKMPRIDKIAYQKKLPIT
FT                   VALKISDLKLLLDYLELGDCVGLVAGSVFLHTLQERPELEFLDITELSTNLFSETSTYK
FT                   ELKYYLQANDSSDHILALKLAEKLREHFSYDNQ"
     MKKIDHLDSF TLSVFVELYE QKSGTAAAAK LAITQSKVSR TLTSLRHIFE NELFIRQQHG        60
     MKPNHLADRL YPLAKTLVAN YQSLAHTMEI TVAENKAVNI AAQGNFHNII FDCLNQVTIG       120
     EGSPFSFELH TITSDFQKKL VNGVFDYCIS INPAQADGIT RYEIGEIGRY FLVAKKGHPI       180
     FNSKITLENI LKYKVAISNY ALDEQKMPRI DKIAYQKKLP ITVALKISDL KLLLDYLELG       240
     DCVGLVAGSV FLHTLQERPE LEFLDITELS TNLFSETSTY KELKYYLQAN DSSDHILALK       300
     LAEKLREHFS YDNQ                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page