(data stored in ACNUC7421 zone)

EMBL: CP000821.PE514

CP000821.PE514       Location/Qualifiers
FT   CDS             631488..632033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0514"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3242 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35127"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQK4"
FT                   /protein_id="ABV35127.1"
FT                   /translation="MRKLLITASLALLLSACGSDDDVSVEPIDPVDPVVPVEPTDPISA
FT                   SVTIDQANEIDVIISSVDPQSFAIAFTLTDADNQAITDAGSDFEVMYLSMPAEITSAFS
FT                   MPWHNASKFGCDAEESDCIDTLVEVSPGSYTFTPASQPVFNMDTQTLRLSVMVAGALAQ
FT                   SKPEIVKPIGDHFWLPTS"
     MRKLLITASL ALLLSACGSD DDVSVEPIDP VDPVVPVEPT DPISASVTID QANEIDVIIS        60
     SVDPQSFAIA FTLTDADNQA ITDAGSDFEV MYLSMPAEIT SAFSMPWHNA SKFGCDAEES       120
     DCIDTLVEVS PGSYTFTPAS QPVFNMDTQT LRLSVMVAGA LAQSKPEIVK PIGDHFWLPT       180
     S                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page