(data stored in ACNUC7421 zone)

EMBL: CP000821.PE515

CP000821.PE515       Location/Qualifiers
FT   CDS             complement(633107..633397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_2184 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35128"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQK5"
FT                   /protein_id="ABV35128.1"
FT                   /translation="MLRILGLTFLLILSGYVLAEPIAETHAEMSGCESCHINGEPSDDM
FT                   VHENSSCVECHGPLSDFADETHQRHHDVLECSNCHLAHDEVKLNDSCVNCH"
     MLRILGLTFL LILSGYVLAE PIAETHAEMS GCESCHINGE PSDDMVHENS SCVECHGPLS        60
     DFADETHQRH HDVLECSNCH LAHDEVKLND SCVNCH                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page