(data stored in ACNUC7421 zone)

EMBL: CP000821.PE517

CP000821.PE517       Location/Qualifiers
FT   CDS             complement(634358..635047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0517"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="KEGG: shw:Sputw3181_3894 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35130"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQK7"
FT                   /protein_id="ABV35130.1"
FT                   /translation="MENKRRLFLKCACATAVGAVGSTKLIAAQSDTKTDDTEAEVNYAL
FT                   IHDETKCIGCEVCVDACRETNNVPEGVSRLEIVKTGPFGEYPDQYFSFSRKSCQQCDGT
FT                   PCVNVCPTGAAYKDPKTGIVSVDSWKCVGCMYCIAACPYQVRFINPVTKAADKCDFCKE
FT                   TRLKEGKSPACVAACPTKALVFGNLKDPDSEIVKVLKTTPNYRSKTDLGTRPKLFRIAA
FT                   KNGEIKL"
     MENKRRLFLK CACATAVGAV GSTKLIAAQS DTKTDDTEAE VNYALIHDET KCIGCEVCVD        60
     ACRETNNVPE GVSRLEIVKT GPFGEYPDQY FSFSRKSCQQ CDGTPCVNVC PTGAAYKDPK       120
     TGIVSVDSWK CVGCMYCIAA CPYQVRFINP VTKAADKCDF CKETRLKEGK SPACVAACPT       180
     KALVFGNLKD PDSEIVKVLK TTPNYRSKTD LGTRPKLFRI AAKNGEIKL                   229
//

If you have problems or comments...

PBIL Back to PBIL home page