(data stored in ACNUC7421 zone)

EMBL: CP000821.PE518

CP000821.PE518       Location/Qualifiers
FT   CDS             complement(635060..635530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0518"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35131"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQK8"
FT                   /protein_id="ABV35131.1"
FT                   /translation="MSSFKKVFTLSILTLTTFISTPLSISYANTLELTINTNKQCIMCH
FT                   KKNGKMFGIHSSNSLELRCQNCHREKEGHPRKKSSLIKFSDHSLNTAEEQTAVCTTCHN
FT                   SDDLTEVDWTHAVHSNKVNCAKCHQLHTETDPVIAISTGERRQLCVNCHESR"
     MSSFKKVFTL SILTLTTFIS TPLSISYANT LELTINTNKQ CIMCHKKNGK MFGIHSSNSL        60
     ELRCQNCHRE KEGHPRKKSS LIKFSDHSLN TAEEQTAVCT TCHNSDDLTE VDWTHAVHSN       120
     KVNCAKCHQL HTETDPVIAI STGERRQLCV NCHESR                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page