(data stored in ACNUC7421 zone)

EMBL: CP000821.PE519

CP000821.PE519       Location/Qualifiers
FT   CDS             complement(635613..636107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3155 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35132"
FT                   /db_xref="GOA:A8FQK9"
FT                   /db_xref="InterPro:IPR024402"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQK9"
FT                   /protein_id="ABV35132.1"
FT                   /translation="MNATVIFNYAFMYFVLFLVVPSVIIVFAMTCIKFFKSEKIQTEGV
FT                   IIELTPEKTKAKFSALTARLNEIARGKYNVLYGASLGSILDVKSDNNHHTYENIKNCQL
FT                   DYVILDEQSSVKLVITDPEHNTPENSDFIDSSLAKVGVNVIHISDNKQCDDLLVRELLV
FT                   A"
     MNATVIFNYA FMYFVLFLVV PSVIIVFAMT CIKFFKSEKI QTEGVIIELT PEKTKAKFSA        60
     LTARLNEIAR GKYNVLYGAS LGSILDVKSD NNHHTYENIK NCQLDYVILD EQSSVKLVIT       120
     DPEHNTPENS DFIDSSLAKV GVNVIHISDN KQCDDLLVRE LLVA                        164
//

If you have problems or comments...

PBIL Back to PBIL home page