(data stored in ACNUC7421 zone)

EMBL: CP000821.PE521

CP000821.PE521       Location/Qualifiers
FT   CDS             complement(637776..638084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0521"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0372 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35134"
FT                   /db_xref="InterPro:IPR024331"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQL1"
FT                   /protein_id="ABV35134.1"
FT                   /translation="MPKNTLSRSLSYTDWYNIRPPFDGEVYVKENDWKFYLGDTIWAPE
FT                   HNKVGKWRMTLELKGKVIAEKTFKVHLNDELPRQTNKSIQMDDDAEKIASFWKRRGC"
     MPKNTLSRSL SYTDWYNIRP PFDGEVYVKE NDWKFYLGDT IWAPEHNKVG KWRMTLELKG        60
     KVIAEKTFKV HLNDELPRQT NKSIQMDDDA EKIASFWKRR GC                          102
//

If you have problems or comments...

PBIL Back to PBIL home page