(data stored in ACNUC7421 zone)

EMBL: CP000821.PE523

CP000821.PE523       Location/Qualifiers
FT   CDS             complement(639199..640302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0524"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="KEGG: vfi:VF0872 methyl-accepting chemotaxis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35136"
FT                   /db_xref="GOA:A8FQL3"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR025991"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQL3"
FT                   /protein_id="ABV35136.1"
FT                   /translation="MLFNNGLKQENAALKQQLQELKDKHDQEIKELVEELKRKDFEHNK
FT                   LHQEQQLDATLITSNLRGGRMLETIRTGLANSAEELIHENEELKQLDEMFAQTHTALSQ
FT                   LEARAQKISEQTDSTMNSATALDETAKSIGQLIVAIQDISSQTNLLALNAAIEAARAGE
FT                   AGRGFAVVADEVRTLAGNAHEASDKIERLVNRVLGQTHEIKTSISENQLYAADISASSE
FT                   QIDVIVKEVLSKSQHMQKVIHLATARSFLDTVKLDHAVWKNNVYSHLQERDYQAQVNKH
FT                   TECRLGKWYFEGAGAEQYSHLASFNGLNQPHQLVHDSGHHAIQAGQSGDQHALIKHVEA
FT                   MEDASEGVVHSIDRLLGEVTSEQRRAL"
     MLFNNGLKQE NAALKQQLQE LKDKHDQEIK ELVEELKRKD FEHNKLHQEQ QLDATLITSN        60
     LRGGRMLETI RTGLANSAEE LIHENEELKQ LDEMFAQTHT ALSQLEARAQ KISEQTDSTM       120
     NSATALDETA KSIGQLIVAI QDISSQTNLL ALNAAIEAAR AGEAGRGFAV VADEVRTLAG       180
     NAHEASDKIE RLVNRVLGQT HEIKTSISEN QLYAADISAS SEQIDVIVKE VLSKSQHMQK       240
     VIHLATARSF LDTVKLDHAV WKNNVYSHLQ ERDYQAQVNK HTECRLGKWY FEGAGAEQYS       300
     HLASFNGLNQ PHQLVHDSGH HAIQAGQSGD QHALIKHVEA MEDASEGVVH SIDRLLGEVT       360
     SEQRRAL                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page