(data stored in ACNUC7421 zone)

EMBL: CP000821.PE525

CP000821.PE525       Location/Qualifiers
FT   CDS             complement(641660..642463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0526"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_4008 transcriptional regulator,
FT                   LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35138"
FT                   /db_xref="GOA:A8FQL5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQL5"
FT                   /protein_id="ABV35138.1"
FT                   /translation="MSAQQSGMVCNRIIESFLEKLAPFGIKRFYYCIIPDELSNVCIVT
FT                   DDQANILNSDGNEELHIAKMIDLKKMRFAVASDPEILKFREEFLHRFARNDEGYQLSGP
FT                   SIRKKYNPYIWPENTMPERRKRSFEQLLNLYQIRTRISFYHPVKDKKGWIGICNLFSSD
FT                   KRGQVIDNISSTPDELETLLREFAETFNALAFKTINPISNFRVLSPTCVEILSLVAQGC
FT                   SSEEVGKQLYMSERGVNYHLDRARVILTARNRTNLVSKAYQSGLL"
     MSAQQSGMVC NRIIESFLEK LAPFGIKRFY YCIIPDELSN VCIVTDDQAN ILNSDGNEEL        60
     HIAKMIDLKK MRFAVASDPE ILKFREEFLH RFARNDEGYQ LSGPSIRKKY NPYIWPENTM       120
     PERRKRSFEQ LLNLYQIRTR ISFYHPVKDK KGWIGICNLF SSDKRGQVID NISSTPDELE       180
     TLLREFAETF NALAFKTINP ISNFRVLSPT CVEILSLVAQ GCSSEEVGKQ LYMSERGVNY       240
     HLDRARVILT ARNRTNLVSK AYQSGLL                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page