(data stored in ACNUC7421 zone)

EMBL: CP000821.PE526

CP000821.PE526       Location/Qualifiers
FT   CDS             complement(642520..644379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35139"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQL6"
FT                   /protein_id="ABV35139.1"
FT                   /translation="MMKRNSIIAVLALSFALGGCGSDDSPTPEPPIPPEPPIVKPDYVF
FT                   GGPTEDEQKLNKVIQFAIVKGFSPLDDSDEAKKSKAKSYSSGHEIEGVLESKMVADAAK
FT                   LGLKVDYLLPPTAINMSGVKIDSIRPDIFQDGRGSVMDLLLWAAKKYNLDIEYEKDENL
FT                   KTHFITSIEGITGLPEVVDQDNLGKTEGQGWKYLVGPSIWEHKKEGSYETESYYYKEEE
FT                   IYFRMDHHPLKNEMSIVLVAAQPGEMDIRKKKYQKEMDRLAENGGKVIIPEIVIDFKPA
FT                   KTTETGEILIPNQRAVFKDIEVTPHNLRSDIYKEGTITELDAWLSLVEQRPDLKIDWSY
FT                   WPRLSTNSNVQGYVATAISFNGRDDVGNIVNERYTNNGSCGFVHHTGEWENYMDSGAQN
FT                   GLYQWVMCSARTDMGGDEYRKACYGQIPGILGYRARNYGEGEQFENHNPKGRGYMKFGL
FT                   PFGGNDPHLTGDAMIIYGPEYINYIGAAFGNGYGNQESTSGCDAEAPEIDPTRIKDISQ
FT                   ARAPLTPSHFGWKIPDCTTCHNAANSHVVQDMAPWECAECHGNNGAPDSHGELLTCGFC
FT                   HAKTLAKHGDAYSTKDDYYSEQTNFKEPESCLTCHVEKQEGTQ"
     MMKRNSIIAV LALSFALGGC GSDDSPTPEP PIPPEPPIVK PDYVFGGPTE DEQKLNKVIQ        60
     FAIVKGFSPL DDSDEAKKSK AKSYSSGHEI EGVLESKMVA DAAKLGLKVD YLLPPTAINM       120
     SGVKIDSIRP DIFQDGRGSV MDLLLWAAKK YNLDIEYEKD ENLKTHFITS IEGITGLPEV       180
     VDQDNLGKTE GQGWKYLVGP SIWEHKKEGS YETESYYYKE EEIYFRMDHH PLKNEMSIVL       240
     VAAQPGEMDI RKKKYQKEMD RLAENGGKVI IPEIVIDFKP AKTTETGEIL IPNQRAVFKD       300
     IEVTPHNLRS DIYKEGTITE LDAWLSLVEQ RPDLKIDWSY WPRLSTNSNV QGYVATAISF       360
     NGRDDVGNIV NERYTNNGSC GFVHHTGEWE NYMDSGAQNG LYQWVMCSAR TDMGGDEYRK       420
     ACYGQIPGIL GYRARNYGEG EQFENHNPKG RGYMKFGLPF GGNDPHLTGD AMIIYGPEYI       480
     NYIGAAFGNG YGNQESTSGC DAEAPEIDPT RIKDISQARA PLTPSHFGWK IPDCTTCHNA       540
     ANSHVVQDMA PWECAECHGN NGAPDSHGEL LTCGFCHAKT LAKHGDAYST KDDYYSEQTN       600
     FKEPESCLTC HVEKQEGTQ                                                    619
//

If you have problems or comments...

PBIL Back to PBIL home page