(data stored in ACNUC7421 zone)

EMBL: CP000821.PE527

CP000821.PE527       Location/Qualifiers
FT   CDS             complement(644770..645162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0528"
FT                   /product="protein of unknown function DUF971"
FT                   /note="KEGG: slo:Shew_0373 protein of unknown function
FT                   DUF971"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35140"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQL7"
FT                   /protein_id="ABV35140.1"
FT                   /translation="MTNPESPMVTALKLKRKSRQLEITFDTGETFQISCEMLRVYSPSA
FT                   EVHGHGNPVLVTHKKNVNIKELTPVGNYAVKITFDDGHDTGLFSWQILHGLATNQVELW
FT                   ENYLARLRAAKASREPLIDMAVKYYK"
     MTNPESPMVT ALKLKRKSRQ LEITFDTGET FQISCEMLRV YSPSAEVHGH GNPVLVTHKK        60
     NVNIKELTPV GNYAVKITFD DGHDTGLFSW QILHGLATNQ VELWENYLAR LRAAKASREP       120
     LIDMAVKYYK                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page