(data stored in ACNUC7421 zone)

EMBL: CP000821.PE528

CP000821.PE528       Location/Qualifiers
FT   CDS             complement(645332..647365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0529"
FT                   /product="Methyl-accepting chemotaxis protein-like protein"
FT                   /note="KEGG: ppr:PBPRB1868 hypothetical chemotaxis
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35141"
FT                   /db_xref="GOA:A8FQL8"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQL8"
FT                   /protein_id="ABV35141.1"
FT                   /translation="MDAILNLTVRLKLLLGFGLVIAIFIISSSIVYTQLQDINTTQSRL
FT                   LELRTPTVQAGMNLEAAITQTLSGLRGYLILGGDPSKAKLFKDERAQGWDKLEQSLMTL
FT                   EGFAKNWTVPRNIERLNEMKMIIRQFKQAQQQIEDIAHTDKNIPSFDILLTKAAPTAAR
FT                   TLTALTAIIESEMANPSDIEHKRFLKTLADSRAAFAMGLANIRAYLLSGELKFKNNYLE
FT                   LKGRSDSLMLDLESSIDLMSVEQREQWDSFKLARSEFAPYVIQMFGSRSSAEWNQANHW
FT                   LGTLAAPRARKIKSILEEMRTSQANLFKADQRSLTEASDTLNFVLLLSGVLTIIFGAVI
FT                   AVAISQSVTRPLGGEPAEMVNIANSIAEGDLTLRFTHAANAKGLYLSMYKMHAKLKELV
FT                   SNIAGAAEQLTDTAVQTSGMSEQTNNNVQDQFQQTELVATAVEEMTVTVNEVSLNASNC
FT                   LSVIQESETTIKEGQENVLQTVGNVEKLASDINDATGVILSLQEKSAEINSVSEVIGSI
FT                   AEQTNLLALNAAIEAARAGEQGRGFAVVADEVRALASKTQESISSINSVILSLQQSADE
FT                   AATAMQSSQNSAENTISEARSSGESLSKIAESSRQIVDMASQISVASEEQASVTLDISQ
FT                   NVQMIRSGAEQTSIGASEMVKTSEQLSTQANSLKSMVASFRY"
     MDAILNLTVR LKLLLGFGLV IAIFIISSSI VYTQLQDINT TQSRLLELRT PTVQAGMNLE        60
     AAITQTLSGL RGYLILGGDP SKAKLFKDER AQGWDKLEQS LMTLEGFAKN WTVPRNIERL       120
     NEMKMIIRQF KQAQQQIEDI AHTDKNIPSF DILLTKAAPT AARTLTALTA IIESEMANPS       180
     DIEHKRFLKT LADSRAAFAM GLANIRAYLL SGELKFKNNY LELKGRSDSL MLDLESSIDL       240
     MSVEQREQWD SFKLARSEFA PYVIQMFGSR SSAEWNQANH WLGTLAAPRA RKIKSILEEM       300
     RTSQANLFKA DQRSLTEASD TLNFVLLLSG VLTIIFGAVI AVAISQSVTR PLGGEPAEMV       360
     NIANSIAEGD LTLRFTHAAN AKGLYLSMYK MHAKLKELVS NIAGAAEQLT DTAVQTSGMS       420
     EQTNNNVQDQ FQQTELVATA VEEMTVTVNE VSLNASNCLS VIQESETTIK EGQENVLQTV       480
     GNVEKLASDI NDATGVILSL QEKSAEINSV SEVIGSIAEQ TNLLALNAAI EAARAGEQGR       540
     GFAVVADEVR ALASKTQESI SSINSVILSL QQSADEAATA MQSSQNSAEN TISEARSSGE       600
     SLSKIAESSR QIVDMASQIS VASEEQASVT LDISQNVQMI RSGAEQTSIG ASEMVKTSEQ       660
     LSTQANSLKS MVASFRY                                                      677
//

If you have problems or comments...

PBIL Back to PBIL home page