(data stored in ACNUC7421 zone)

EMBL: CP000821.PE529

CP000821.PE529       Location/Qualifiers
FT   CDS             complement(647610..648935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0530"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="KEGG: slo:Shew_0374 heat shock protein HslVU, ATPase
FT                   subunit HslU"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35142"
FT                   /db_xref="GOA:A8FQL9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQL9"
FT                   /protein_id="ABV35142.1"
FT                   /translation="MSEMTPREIVHELDTHIIGQHDAKRSVAIALRNRWRRMQLDVDFR
FT                   QEVTPKNILMIGPTGVGKTEIARRLAKLAKAPFIKVEATKFTEVGYVGKEVEQIIRDLT
FT                   DSAIKMTREDQMKKCKFKAEEAAEERILDALLPKPKEDWDNEKPDDSATRQIFRKKLRE
FT                   GQLDDKEIEIDVAAPQVGIEIMSPPGMEEMTNQLQSMFQNMGPGDSKRRKMPIKEAYKL
FT                   MIEEEAAKLVNQDDMKEQAIELVEQHGIVFLDEIDKICKRGESSGPDVSREGVQRDLLP
FT                   LVEGCTVNTKHGMVKTDHILFIASGAFQMSKPSDLIPELQGRLPIRVELSALTADDFKR
FT                   ILTEPHASLTEQHVAMMGTEDVKIEFTEDGIESIAQAAWQVNERTENIGARRLHTVMER
FT                   LMEDLSYDASDKSGNTFVIDAEYVSSHLDDLVQDEDLSRFIL"
     MSEMTPREIV HELDTHIIGQ HDAKRSVAIA LRNRWRRMQL DVDFRQEVTP KNILMIGPTG        60
     VGKTEIARRL AKLAKAPFIK VEATKFTEVG YVGKEVEQII RDLTDSAIKM TREDQMKKCK       120
     FKAEEAAEER ILDALLPKPK EDWDNEKPDD SATRQIFRKK LREGQLDDKE IEIDVAAPQV       180
     GIEIMSPPGM EEMTNQLQSM FQNMGPGDSK RRKMPIKEAY KLMIEEEAAK LVNQDDMKEQ       240
     AIELVEQHGI VFLDEIDKIC KRGESSGPDV SREGVQRDLL PLVEGCTVNT KHGMVKTDHI       300
     LFIASGAFQM SKPSDLIPEL QGRLPIRVEL SALTADDFKR ILTEPHASLT EQHVAMMGTE       360
     DVKIEFTEDG IESIAQAAWQ VNERTENIGA RRLHTVMERL MEDLSYDASD KSGNTFVIDA       420
     EYVSSHLDDL VQDEDLSRFI L                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page