(data stored in ACNUC7421 zone)

EMBL: CP000821.PE53

CP000821.PE53        Location/Qualifiers
FT   CDS             complement(64688..65839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0053"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_3952 flagellar hook-length control
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34666"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP93"
FT                   /protein_id="ABV34666.1"
FT                   /translation="MISNVIDLSSGIGGTKDSLTGTKIANSQQEEPGTQASYSACSASS
FT                   IAERIPEQEAAIVSDLPPVGTLNLLISPAQTQVSTTQSGQTSPGQFMISGEYQASLNPS
FT                   GVETLNRFLHLSNDQNQTAPPFVTSPPLQGGTYSASDASKTSAHNTAQVSQLQTLTGKA
FT                   NETPLSLNQTQTSSLPLPEQPGGKHPFSSQFSASLSGERNANLHLPLTLAESRLSDVNE
FT                   AAVQVLAGGHRTQAPVSQWGPVPVTSAAPLAHQAQEMLSPLREQIRFQVDQQIKQAELR
FT                   LDPPELGKVELSIRLDGDRLHIQMHAANASVRDSLLIGLERLRAELAMDHGGQIDVDIN
FT                   QGKQEQRESSPEASSISLARGDEPDNHSTKHDSQQSNQIDLLA"
     MISNVIDLSS GIGGTKDSLT GTKIANSQQE EPGTQASYSA CSASSIAERI PEQEAAIVSD        60
     LPPVGTLNLL ISPAQTQVST TQSGQTSPGQ FMISGEYQAS LNPSGVETLN RFLHLSNDQN       120
     QTAPPFVTSP PLQGGTYSAS DASKTSAHNT AQVSQLQTLT GKANETPLSL NQTQTSSLPL       180
     PEQPGGKHPF SSQFSASLSG ERNANLHLPL TLAESRLSDV NEAAVQVLAG GHRTQAPVSQ       240
     WGPVPVTSAA PLAHQAQEML SPLREQIRFQ VDQQIKQAEL RLDPPELGKV ELSIRLDGDR       300
     LHIQMHAANA SVRDSLLIGL ERLRAELAMD HGGQIDVDIN QGKQEQRESS PEASSISLAR       360
     GDEPDNHSTK HDSQQSNQID LLA                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page