(data stored in ACNUC7421 zone)

EMBL: CP000821.PE531

CP000821.PE531       Location/Qualifiers
FT   CDS             complement(649764..650330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0532"
FT                   /product="sporulation domain protein"
FT                   /note="KEGG: slo:Shew_0377 sporulation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35144"
FT                   /db_xref="GOA:A8FQM1"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQM1"
FT                   /protein_id="ABV35144.1"
FT                   /translation="MKNRDYANRKPAKGKGKTARRGKQAPAPRRFPVLLLLITVSLLGG
FT                   FGYFLWSINDSAETTSPDVVEQPKKTVVKKDPNALPPKPKEEWTYQRELENKQVEVDIP
FT                   EQTAPTRPYQMQCGSFRTQSQAEQMKAVIAFQGLSANVRKVKGTTGDWYKVSLGPYDRK
FT                   RLAEKHRHILQGAGINGCIILYWEG"
     MKNRDYANRK PAKGKGKTAR RGKQAPAPRR FPVLLLLITV SLLGGFGYFL WSINDSAETT        60
     SPDVVEQPKK TVVKKDPNAL PPKPKEEWTY QRELENKQVE VDIPEQTAPT RPYQMQCGSF       120
     RTQSQAEQMK AVIAFQGLSA NVRKVKGTTG DWYKVSLGPY DRKRLAEKHR HILQGAGING       180
     CIILYWEG                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page