(data stored in ACNUC7421 zone)

EMBL: CP000821.PE533

CP000821.PE533       Location/Qualifiers
FT   CDS             complement(652346..654574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0534"
FT                   /product="primosomal protein N'"
FT                   /note="KEGG: slo:Shew_0379 primosomal protein N'"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35146"
FT                   /db_xref="GOA:A8FQM3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQM3"
FT                   /protein_id="ABV35146.1"
FT                   /translation="MLVSIDQSCHPMPLFVEVALPVPMRQAFSYKVPDSISTLPKKGMR
FT                   VKVPFGRQQLIGLVTGISDTCNLAPQQIKSIFELLDDEPLLPDSLYKLTAWAARYYFCS
FT                   LGQMLSQAIPVALRKGAEISSNTTTFWHLTQSGRSASLDTLKRAPAQKKVMEHLLKGEL
FT                   TQDEISSLALSKSALKALNERAWITQDERVNSIDLSWREKLELDEDPLTLNPEQAIAVA
FT                   TLNQQTGYHCTLLEGITGSGKTEVYLALLESVLSKGKQALILVPEIGLTPQTISRFKSR
FT                   FKVQVAVIHSGLTDNQRLAAWQQAKTGEAAIIIGTRSALFTPMAFPGVIILDEEHDSSF
FT                   KQQEGVGYHARDLAVMRGHLEKIPVLLGTATPSLESLQNALSGRYKHLELGQRAGNAEK
FT                   VRQGIIDISNQPLNTGLSHALLNEMRIHLDAGNQVLLFLNRRGFAPALLCHECGHLHEC
FT                   DRCDAFFTVHQSLGEIRCHHCGNHYAIPKQCHNCGSTMLMGQGVGTEQLANILEKEFPK
FT                   YPVVRIDRDTTSRKGALEAHLNAIHKGEYKILVGTQMLAKGHHFPDVTLVGLLDVDGAL
FT                   FSADFRAPERFGQLYTQVSGRAGRARKPGTVLMQTHQADNPVLRELMHKGYGEFARGQL
FT                   NERKQALLPPAWHMLLIRAEAHQALDADNFLSQVAELLPQNEESEVIGPMPAPMDKKAG
FT                   KYRRHLIFQTKSRNQLQHAFEHALPQIESLPLAKRCRWSLDRDPQDLL"
     MLVSIDQSCH PMPLFVEVAL PVPMRQAFSY KVPDSISTLP KKGMRVKVPF GRQQLIGLVT        60
     GISDTCNLAP QQIKSIFELL DDEPLLPDSL YKLTAWAARY YFCSLGQMLS QAIPVALRKG       120
     AEISSNTTTF WHLTQSGRSA SLDTLKRAPA QKKVMEHLLK GELTQDEISS LALSKSALKA       180
     LNERAWITQD ERVNSIDLSW REKLELDEDP LTLNPEQAIA VATLNQQTGY HCTLLEGITG       240
     SGKTEVYLAL LESVLSKGKQ ALILVPEIGL TPQTISRFKS RFKVQVAVIH SGLTDNQRLA       300
     AWQQAKTGEA AIIIGTRSAL FTPMAFPGVI ILDEEHDSSF KQQEGVGYHA RDLAVMRGHL       360
     EKIPVLLGTA TPSLESLQNA LSGRYKHLEL GQRAGNAEKV RQGIIDISNQ PLNTGLSHAL       420
     LNEMRIHLDA GNQVLLFLNR RGFAPALLCH ECGHLHECDR CDAFFTVHQS LGEIRCHHCG       480
     NHYAIPKQCH NCGSTMLMGQ GVGTEQLANI LEKEFPKYPV VRIDRDTTSR KGALEAHLNA       540
     IHKGEYKILV GTQMLAKGHH FPDVTLVGLL DVDGALFSAD FRAPERFGQL YTQVSGRAGR       600
     ARKPGTVLMQ THQADNPVLR ELMHKGYGEF ARGQLNERKQ ALLPPAWHML LIRAEAHQAL       660
     DADNFLSQVA ELLPQNEESE VIGPMPAPMD KKAGKYRRHL IFQTKSRNQL QHAFEHALPQ       720
     IESLPLAKRC RWSLDRDPQD LL                                                742
//

If you have problems or comments...

PBIL Back to PBIL home page