(data stored in ACNUC7421 zone)

EMBL: CP000821.PE534

CP000821.PE534       Location/Qualifiers
FT   CDS             654629..655435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0535"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0380 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35147"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQM4"
FT                   /protein_id="ABV35147.1"
FT                   /translation="MARIIQIALFSFFLISVQFLGASYANAQMTHVSINQQLFGLGDYP
FT                   KLRVNIVSGHENLDKVQFIVRQTSGDERLMVKPINNFMLLLTGVDDVVDPSAQLIVKEY
FT                   RVNQWHLIKTLALFTDEQIAKGFSAKTQPKPKPKAKQKQVKQKVEVESGVAVSTKSTQN
FT                   SKPASAALLAAQTSNTSTVAELTQDNCVLEYDGNQTLWRIGTQYSQEWEMGTYGAMLAI
FT                   FEANPKAFNKGEISGLRADVALLCPSVPLKEKYRDNQMAKRIYEKL"
     MARIIQIALF SFFLISVQFL GASYANAQMT HVSINQQLFG LGDYPKLRVN IVSGHENLDK        60
     VQFIVRQTSG DERLMVKPIN NFMLLLTGVD DVVDPSAQLI VKEYRVNQWH LIKTLALFTD       120
     EQIAKGFSAK TQPKPKPKAK QKQVKQKVEV ESGVAVSTKS TQNSKPASAA LLAAQTSNTS       180
     TVAELTQDNC VLEYDGNQTL WRIGTQYSQE WEMGTYGAML AIFEANPKAF NKGEISGLRA       240
     DVALLCPSVP LKEKYRDNQM AKRIYEKL                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page