(data stored in ACNUC7421 zone)

EMBL: CP000821.PE535

CP000821.PE535       Location/Qualifiers
FT   CDS             655695..655907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0536"
FT                   /product="ribosomal protein L31"
FT                   /note="KEGG: sdn:Sden_3354 ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35148"
FT                   /db_xref="GOA:A8FQM5"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQM5"
FT                   /protein_id="ABV35148.1"
FT                   /translation="MKADIHPAYAEITATCTCGNVIKVNSTAGKALHLDVCGACHPFYT
FT                   GTQKIVDTGGRIDKFNKRFGALGKK"
     MKADIHPAYA EITATCTCGN VIKVNSTAGK ALHLDVCGAC HPFYTGTQKI VDTGGRIDKF        60
     NKRFGALGKK                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page