(data stored in ACNUC7421 zone)

EMBL: CP000821.PE536

CP000821.PE536       Location/Qualifiers
FT   CDS             656060..656920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0537"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="KEGG: slo:Shew_0382 nuclease (SNase domain protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35149"
FT                   /db_xref="GOA:A8FQM6"
FT                   /db_xref="InterPro:IPR002071"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQM6"
FT                   /protein_id="ABV35149.1"
FT                   /translation="MNTFQLPSSSMLLTNLFFLTLALTILPTTQAAQAKITQQEGQVLN
FT                   DGVTSALCAPTHYDEQVELKYVNDGDTITLKDGRLVRLIGVDSPELDFKSPELSEPYAK
FT                   EARHFLQKELKPGQILNLSFDQKRLDPYGRTLAYVYTENGEHLQELLLSQGFAKTRVYQ
FT                   NDYFWQCLNQVELTARDKELGLWSHPDYRAKTVDELGRSDRNRWGEVKGVVTGYERKGQ
FT                   YLWLILDEKFYVGIPRAESGKFSNILNLNLLESPVIVRGSLYYSYKKWQLISSHPSQIS
FT                   LQNRP"
     MNTFQLPSSS MLLTNLFFLT LALTILPTTQ AAQAKITQQE GQVLNDGVTS ALCAPTHYDE        60
     QVELKYVNDG DTITLKDGRL VRLIGVDSPE LDFKSPELSE PYAKEARHFL QKELKPGQIL       120
     NLSFDQKRLD PYGRTLAYVY TENGEHLQEL LLSQGFAKTR VYQNDYFWQC LNQVELTARD       180
     KELGLWSHPD YRAKTVDELG RSDRNRWGEV KGVVTGYERK GQYLWLILDE KFYVGIPRAE       240
     SGKFSNILNL NLLESPVIVR GSLYYSYKKW QLISSHPSQI SLQNRP                      286
//

If you have problems or comments...

PBIL Back to PBIL home page