(data stored in ACNUC7421 zone)

EMBL: CP000821.PE539

CP000821.PE539       Location/Qualifiers
FT   CDS             660903..661817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0540"
FT                   /product="conserved hypothetical biogenesis protein MshI"
FT                   /note="KEGG: sbl:Sbal_3839 conserved hypothetical
FT                   biogenesis protein MshI"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35152"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQM9"
FT                   /protein_id="ABV35152.1"
FT                   /translation="MGKSLFSRLAFWQKSNSKIKIGIYVCPDKLIVYRAIDDSENSDEL
FT                   KATYEFVFDGTDWSGVFALIAKQFAPAQIQITLCSAFYQLLLVDKPNVESEEMTQALLW
FT                   SVKDMVSQPVTDIHLDYFEPPLPGHTKLNVVVVEKASLSALVLAAKDHDMEVVGINIEE
FT                   MAVTNLFTEEAQARLVLSHTSGQELLLTVVRQGELFMQRRVRGFNQLDSVSAEDLAFGL
FT                   ADNLSLELQRSMDYFESQLRQAPVASIELLINGHVGKLAELVSANFNQKVNAIEVDSVE
FT                   AKMAALALDEFNRDESAERGMNS"
     MGKSLFSRLA FWQKSNSKIK IGIYVCPDKL IVYRAIDDSE NSDELKATYE FVFDGTDWSG        60
     VFALIAKQFA PAQIQITLCS AFYQLLLVDK PNVESEEMTQ ALLWSVKDMV SQPVTDIHLD       120
     YFEPPLPGHT KLNVVVVEKA SLSALVLAAK DHDMEVVGIN IEEMAVTNLF TEEAQARLVL       180
     SHTSGQELLL TVVRQGELFM QRRVRGFNQL DSVSAEDLAF GLADNLSLEL QRSMDYFESQ       240
     LRQAPVASIE LLINGHVGKL AELVSANFNQ KVNAIEVDSV EAKMAALALD EFNRDESAER       300
     GMNS                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page