(data stored in ACNUC7421 zone)

EMBL: CP000821.PE54

CP000821.PE54        Location/Qualifiers
FT   CDS             complement(65829..66155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0054"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0487 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34667"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP94"
FT                   /protein_id="ABV34667.1"
FT                   /translation="MSEKAGPTSIELWKRFETALQEYANAEDWDKVVKVNALMVLALKK
FT                   AGKPATKSQLVARKALATTHANILQNLHQKKDKLQQDIHQFKGQQDGLAAYQLTRLSGE
FT                   INDI"
     MSEKAGPTSI ELWKRFETAL QEYANAEDWD KVVKVNALMV LALKKAGKPA TKSQLVARKA        60
     LATTHANILQ NLHQKKDKLQ QDIHQFKGQQ DGLAAYQLTR LSGEINDI                    108
//

If you have problems or comments...

PBIL Back to PBIL home page