(data stored in ACNUC7421 zone)

EMBL: CP000821.PE540

CP000821.PE540       Location/Qualifiers
FT   CDS             661814..662425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0541"
FT                   /product="fimbrial assembly family protein"
FT                   /note="KEGG: slo:Shew_0386 fimbrial assembly family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35153"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQN0"
FT                   /protein_id="ABV35153.1"
FT                   /translation="MTMKTRVNLFSASLLPPELRLSFNHLTLVLLVLVGLFTIAIGGSY
FT                   ALVSALETDKAELNKQKRNLDNQKQDLETALANRAPDSALVDEVDLLSQQVELKRMLLG
FT                   ELSQREALTSHGYSPLMKDLARVANSNIWLSRIQVDNNSFIFEGFSSAPHSVPLWVDRL
FT                   KLTDTLKGHAFASMTMSRGEGKPLAFTLTSKAGDSVENNQ"
     MTMKTRVNLF SASLLPPELR LSFNHLTLVL LVLVGLFTIA IGGSYALVSA LETDKAELNK        60
     QKRNLDNQKQ DLETALANRA PDSALVDEVD LLSQQVELKR MLLGELSQRE ALTSHGYSPL       120
     MKDLARVANS NIWLSRIQVD NNSFIFEGFS SAPHSVPLWV DRLKLTDTLK GHAFASMTMS       180
     RGEGKPLAFT LTSKAGDSVE NNQ                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page