(data stored in ACNUC7421 zone)

EMBL: CP000821.PE541

CP000821.PE541       Location/Qualifiers
FT   CDS             662422..663072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0542"
FT                   /product="MSHA biogenesis protein MshJ"
FT                   /note="KEGG: slo:Shew_0387 MSHA biogenesis protein MshJ"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35154"
FT                   /db_xref="GOA:A8FQN1"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQN1"
FT                   /protein_id="ABV35154.1"
FT                   /translation="MKQRWQALGERFDLLSQRERVMVATAAVVVIGMLCYLPLESLLLK
FT                   YNALSKQITAITAENKISLQQIELYEQRLAQDPNDEYNNRLQVLKQQSADLDDQLSFQM
FT                   VDMIPADHMPTLLSQLLGKVTGIKLQEFKSIAPTPLLALDDEKKTNLYSHGIRLTLEGD
FT                   YFSLLKFIEAVESMPNKLYWKQMDYKVEEYPGANVVLELYTISVNKDFISVAN"
     MKQRWQALGE RFDLLSQRER VMVATAAVVV IGMLCYLPLE SLLLKYNALS KQITAITAEN        60
     KISLQQIELY EQRLAQDPND EYNNRLQVLK QQSADLDDQL SFQMVDMIPA DHMPTLLSQL       120
     LGKVTGIKLQ EFKSIAPTPL LALDDEKKTN LYSHGIRLTL EGDYFSLLKF IEAVESMPNK       180
     LYWKQMDYKV EEYPGANVVL ELYTISVNKD FISVAN                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page