(data stored in ACNUC7421 zone)

EMBL: CP000821.PE542

CP000821.PE542       Location/Qualifiers
FT   CDS             663059..663409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0543"
FT                   /product="MSHA biogenesis protein MshK"
FT                   /note="KEGG: she:Shewmr4_3487 MSHA biogenesis protein MshK"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35155"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQN2"
FT                   /protein_id="ABV35155.1"
FT                   /translation="MLQIKASSLFSVFVSLLVLVTSTLHAETLRDPTRPGRGAVITDAR
FT                   ASGHANALVLNSVLKGETSSHAVINNKIFVLGDRVQGVKIVRIDSSSVSLADGRKLKMY
FT                   QAITETKGNKFK"
     MLQIKASSLF SVFVSLLVLV TSTLHAETLR DPTRPGRGAV ITDARASGHA NALVLNSVLK        60
     GETSSHAVIN NKIFVLGDRV QGVKIVRIDS SSVSLADGRK LKMYQAITET KGNKFK           116
//

If you have problems or comments...

PBIL Back to PBIL home page