(data stored in ACNUC7421 zone)

EMBL: CP000821.PE543

CP000821.PE543       Location/Qualifiers
FT   CDS             663406..665109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0544"
FT                   /product="pilus (MSHA type) biogenesis protein MshL"
FT                   /note="KEGG: slo:Shew_0389 pilus (MSHA type) biogenesis
FT                   protein MshL"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35156"
FT                   /db_xref="GOA:A8FQN3"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR011514"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013358"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQN3"
FT                   /protein_id="ABV35156.1"
FT                   /translation="MRAINIITPLIALLLAACQTTDRPQPIESKQVLSDSVQAEQNRTT
FT                   TPPPAVMPDAIQKELASKELLSGLSPVLRTERRFDVSANDVDAKVFFPSLVQGSPLSVA
FT                   VHPGVSGTISLSLKGVTLSEALQVVEDIYGYEVSREGRILRIFPSGMRTETFPLNYLYM
FT                   ERQGLSLTSVNSGRISDSNDSNSSGSNNSNNSSNNSNSNSSNNNSDSNGNNSSNDTTNG
FT                   TFIRSTTKTDFWGELEKTLVSIVGSTGGGRQVVVTPQAGLVTVRGYPNELRQVRTFLQT
FT                   AETHLQRQVILEAKILEVTLSDGYQQGIQWDNVLGHVGSTDITFGTSENTEGLGDLITN
FT                   AIGGVTSLSVKGSNFNTMINLLDTQGDVDVLSSPRVTASNNQKAVIKVGTDEYFVTDVS
FT                   STTVAGTTPVTTPEVELTPFFSGIALDVTPQIDGEGNILLHIHPSVIDIKEQTKVIKIS
FT                   GSSLELPLAQSDIRESDTVIKAKTGDVVVIGGLMKSENIEVESKVPLLGDIPLVGELFT
FT                   NRSKSLKKTELVILLKPTVVGADTWRKELQKSKALLDRWYPEEDENGQGQ"
     MRAINIITPL IALLLAACQT TDRPQPIESK QVLSDSVQAE QNRTTTPPPA VMPDAIQKEL        60
     ASKELLSGLS PVLRTERRFD VSANDVDAKV FFPSLVQGSP LSVAVHPGVS GTISLSLKGV       120
     TLSEALQVVE DIYGYEVSRE GRILRIFPSG MRTETFPLNY LYMERQGLSL TSVNSGRISD       180
     SNDSNSSGSN NSNNSSNNSN SNSSNNNSDS NGNNSSNDTT NGTFIRSTTK TDFWGELEKT       240
     LVSIVGSTGG GRQVVVTPQA GLVTVRGYPN ELRQVRTFLQ TAETHLQRQV ILEAKILEVT       300
     LSDGYQQGIQ WDNVLGHVGS TDITFGTSEN TEGLGDLITN AIGGVTSLSV KGSNFNTMIN       360
     LLDTQGDVDV LSSPRVTASN NQKAVIKVGT DEYFVTDVSS TTVAGTTPVT TPEVELTPFF       420
     SGIALDVTPQ IDGEGNILLH IHPSVIDIKE QTKVIKISGS SLELPLAQSD IRESDTVIKA       480
     KTGDVVVIGG LMKSENIEVE SKVPLLGDIP LVGELFTNRS KSLKKTELVI LLKPTVVGAD       540
     TWRKELQKSK ALLDRWYPEE DENGQGQ                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page