(data stored in ACNUC7421 zone)

EMBL: CP000821.PE544

CP000821.PE544       Location/Qualifiers
FT   CDS             665113..666021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0545"
FT                   /product="MSHA biogenesis protein MshM"
FT                   /note="KEGG: sbl:Sbal_3834 MSHA biogenesis protein MshM"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35157"
FT                   /db_xref="GOA:A8FQN4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQN4"
FT                   /protein_id="ABV35157.1"
FT                   /translation="MYLQHFGLAETPFSLTPNTEFFFGLAPHVEALQVLQTALQTGEGF
FT                   IKVTGEVGTGKTLICRKLINELPKRFHCAYLPNPYLSPAELRWAVALELGLKYSADIDQ
FT                   MQLTGLIQQQLLALCAHGHSIVLVLDEAQALPDESLEALRLFTNLETESRKLLQVVLFA
FT                   QPELDQRLSLHNFRQLRQRITFSYCLRALTLDEAEAYVQHRLSVAGRVGKPLFSHRDTR
FT                   LLAKASKGIPRLINILAHKALLLSFGEGSHQIEYRHVKAAIVDTEDTKLGFQTNWLWFM
FT                   GFGMMSMLAGAGLHLFYGGVS"
     MYLQHFGLAE TPFSLTPNTE FFFGLAPHVE ALQVLQTALQ TGEGFIKVTG EVGTGKTLIC        60
     RKLINELPKR FHCAYLPNPY LSPAELRWAV ALELGLKYSA DIDQMQLTGL IQQQLLALCA       120
     HGHSIVLVLD EAQALPDESL EALRLFTNLE TESRKLLQVV LFAQPELDQR LSLHNFRQLR       180
     QRITFSYCLR ALTLDEAEAY VQHRLSVAGR VGKPLFSHRD TRLLAKASKG IPRLINILAH       240
     KALLLSFGEG SHQIEYRHVK AAIVDTEDTK LGFQTNWLWF MGFGMMSMLA GAGLHLFYGG       300
     VS                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page