(data stored in ACNUC7421 zone)

EMBL: CP000821.PE545

CP000821.PE545       Location/Qualifiers
FT   CDS             666018..667259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0546"
FT                   /product="tetratricopeptide TPR_2 repeat protein"
FT                   /note="KEGG: slo:Shew_0391 tetratricopeptide TPR_2 repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQN5"
FT                   /protein_id="ABV35158.1"
FT                   /translation="MSVINTMLKDLDKRQQSHELENLHVAPVQYQSSTPSKLPWMLLGL
FT                   VSLVLVSGIVFSWDRLTAKVSDDEAVLSVDSKSTENKAVDIKLAENMATENKAGALDEP
FT                   GLTSVAAPSIGADNRVAPEGKPDAGVTVKSEQRLTQLPAIPEQKRSSESGVKAAAKPII
FT                   KEQQVAAEEALPVITSKKQRTTSTPVSQSVKAEAPVVRSSNNGSMAVTEVKLSDDQLAQ
FT                   KRLMLASEAEQQGGQNDAIVYYNEALTLNPKLHQARKQLAALYYGKGRLDLATDLLRQG
FT                   ISLFPAEFDYVLLLARVQLASGNKAQALSTLSQIPDSSLLARQKWVEQSSLAQEVSDFV
FT                   LAEQGYRNLLGVEANQARWWMGLAYSLDAQAKYSAAKDAYKQAVLYKSVPGKGLSAQAF
FT                   DYIENRLTQLGEIE"
     MSVINTMLKD LDKRQQSHEL ENLHVAPVQY QSSTPSKLPW MLLGLVSLVL VSGIVFSWDR        60
     LTAKVSDDEA VLSVDSKSTE NKAVDIKLAE NMATENKAGA LDEPGLTSVA APSIGADNRV       120
     APEGKPDAGV TVKSEQRLTQ LPAIPEQKRS SESGVKAAAK PIIKEQQVAA EEALPVITSK       180
     KQRTTSTPVS QSVKAEAPVV RSSNNGSMAV TEVKLSDDQL AQKRLMLASE AEQQGGQNDA       240
     IVYYNEALTL NPKLHQARKQ LAALYYGKGR LDLATDLLRQ GISLFPAEFD YVLLLARVQL       300
     ASGNKAQALS TLSQIPDSSL LARQKWVEQS SLAQEVSDFV LAEQGYRNLL GVEANQARWW       360
     MGLAYSLDAQ AKYSAAKDAY KQAVLYKSVP GKGLSAQAFD YIENRLTQLG EIE              413
//

If you have problems or comments...

PBIL Back to PBIL home page