(data stored in ACNUC7421 zone)

EMBL: CP000821.PE546

CP000821.PE546       Location/Qualifiers
FT   CDS             667256..669010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0547"
FT                   /product="type II secretion system protein E"
FT                   /note="KEGG: shm:Shewmr7_0469 type II secretion system
FT                   protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35159"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQN6"
FT                   /protein_id="ABV35159.1"
FT                   /translation="MKPKLKMRLGDLLVQEQIISEPQLMEALTEQRSTGKKLGRTLIDL
FT                   NSISEEQLLRFLSQQLHIPFIDISKRPIPPEVVNLLPEVQARRFRALVVEDNGDSALVA
FT                   MSDPADLQAMDNLEVLLTPKRLEIAVVTEGQLLDAFDNIYRRTDEIAQIAGKLEEEYAA
FT                   DDQFDLASLTDSDSDNETTVVRLLQSIFEDAVQMRASDIHIEPGDKVLRIRQRIDGQLH
FT                   ENILPEASIAAALVLRLKLMAGLDISEKRLPQDGRFHMEIKGHQIDVRMSTMPIYHGES
FT                   VVMRLLDQSAGLLTLNETGMPPEILERVRKQIKRPHGMLLVTGPTGSGKTTTLYGVLSE
FT                   LNTADRKIITVEDPVEYQLPRINQVQVNHKIGLDFSNVLRTTLRQDPDIIMVGEMRDQE
FT                   TVEIGLRGALTGHFVLSTLHTNDAVTSALRLLDMGAASYLVASALRVIIAQRLVRRVCQ
FT                   NCAREYELTAQDKAWLNSTSQQDFSQAKFRIGSGCQSCNGSGYRGRIGIFEILELDEAM
FT                   IDAMRTGNPQDFARAAYLSPNFIPLAVSAFKYLAEGMTTIEEVAKLVEDVNETESPLSI
FT                   RQQQGTEF"
     MKPKLKMRLG DLLVQEQIIS EPQLMEALTE QRSTGKKLGR TLIDLNSISE EQLLRFLSQQ        60
     LHIPFIDISK RPIPPEVVNL LPEVQARRFR ALVVEDNGDS ALVAMSDPAD LQAMDNLEVL       120
     LTPKRLEIAV VTEGQLLDAF DNIYRRTDEI AQIAGKLEEE YAADDQFDLA SLTDSDSDNE       180
     TTVVRLLQSI FEDAVQMRAS DIHIEPGDKV LRIRQRIDGQ LHENILPEAS IAAALVLRLK       240
     LMAGLDISEK RLPQDGRFHM EIKGHQIDVR MSTMPIYHGE SVVMRLLDQS AGLLTLNETG       300
     MPPEILERVR KQIKRPHGML LVTGPTGSGK TTTLYGVLSE LNTADRKIIT VEDPVEYQLP       360
     RINQVQVNHK IGLDFSNVLR TTLRQDPDII MVGEMRDQET VEIGLRGALT GHFVLSTLHT       420
     NDAVTSALRL LDMGAASYLV ASALRVIIAQ RLVRRVCQNC AREYELTAQD KAWLNSTSQQ       480
     DFSQAKFRIG SGCQSCNGSG YRGRIGIFEI LELDEAMIDA MRTGNPQDFA RAAYLSPNFI       540
     PLAVSAFKYL AEGMTTIEEV AKLVEDVNET ESPLSIRQQQ GTEF                        584
//

If you have problems or comments...

PBIL Back to PBIL home page