(data stored in ACNUC7421 zone)

EMBL: CP000821.PE547

CP000821.PE547       Location/Qualifiers
FT   CDS             669099..670319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0548"
FT                   /product="type II secretion system protein"
FT                   /note="KEGG: shn:Shewana3_3659 type II secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35160"
FT                   /db_xref="GOA:A8FQN7"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQN7"
FT                   /protein_id="ABV35160.1"
FT                   /translation="MATYKYRGRDAQGQQVTGLVDAASESAAADQLMSRAVIPLELDEA
FT                   KEKREFSLASLFKGKVSLDELQIFSRQMYSLTRSGIPILRAIAGLSETTHSQRMRDALN
FT                   DISEQLTSGRPLSSAMNHHPDVFDALFVSMVHVGENTGKLEDAFIQLAGYIEREQETRR
FT                   RIKAAMRYPIFVLIAIALAMVILNIMVIPKFAEMFSRFGADLPWATKVLIGTSNLFVNY
FT                   WPAMLVGLVATFIGIRYWHSTEKGEKQWDSWKLHIPAVGSIIERSTLSRYCRSFSMMLS
FT                   AGVPMTQALSLVADAVDNAYMHDRIVGMRRGIESGDSMLRVSNQSQLFTPLVLQMVAVG
FT                   EETGQIDQLLNDAADFYEGEVDYDLKNLTAKLEPILIGFVAGIVLILALGIYLPMWDML
FT                   NVVKGGS"
     MATYKYRGRD AQGQQVTGLV DAASESAAAD QLMSRAVIPL ELDEAKEKRE FSLASLFKGK        60
     VSLDELQIFS RQMYSLTRSG IPILRAIAGL SETTHSQRMR DALNDISEQL TSGRPLSSAM       120
     NHHPDVFDAL FVSMVHVGEN TGKLEDAFIQ LAGYIEREQE TRRRIKAAMR YPIFVLIAIA       180
     LAMVILNIMV IPKFAEMFSR FGADLPWATK VLIGTSNLFV NYWPAMLVGL VATFIGIRYW       240
     HSTEKGEKQW DSWKLHIPAV GSIIERSTLS RYCRSFSMML SAGVPMTQAL SLVADAVDNA       300
     YMHDRIVGMR RGIESGDSML RVSNQSQLFT PLVLQMVAVG EETGQIDQLL NDAADFYEGE       360
     VDYDLKNLTA KLEPILIGFV AGIVLILALG IYLPMWDMLN VVKGGS                      406
//

If you have problems or comments...

PBIL Back to PBIL home page