(data stored in ACNUC7421 zone)

EMBL: CP000821.PE548

CP000821.PE548       Location/Qualifiers
FT   CDS             670354..670875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0549"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0394 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35161"
FT                   /db_xref="GOA:A8FQN8"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQN8"
FT                   /protein_id="ABV35161.1"
FT                   /translation="MQSQQQADGELVQMFGKVIAIVLLLTLLSILGFRYFASVDKISAQ
FT                   GLRLDHSKLLNVLAMVKGQWLAKGRPSEMRLEWDTSGFQDSEPFIIEGENSEEHTLVKM
FT                   SHGGWPLLDTADSVGCKQLWRQLLGRELVEQQVVTQLNPEGDVCSYIANNSDRLSYQLS
FT                   TGRVVFLTKE"
     MQSQQQADGE LVQMFGKVIA IVLLLTLLSI LGFRYFASVD KISAQGLRLD HSKLLNVLAM        60
     VKGQWLAKGR PSEMRLEWDT SGFQDSEPFI IEGENSEEHT LVKMSHGGWP LLDTADSVGC       120
     KQLWRQLLGR ELVEQQVVTQ LNPEGDVCSY IANNSDRLSY QLSTGRVVFL TKE              173
//

If you have problems or comments...

PBIL Back to PBIL home page