(data stored in ACNUC7421 zone)

EMBL: CP000821.PE549

CP000821.PE549       Location/Qualifiers
FT   CDS             670947..671603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0550"
FT                   /product="methylation site containing protein"
FT                   /note="KEGG: slo:Shew_0395 methylation site containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35162"
FT                   /db_xref="GOA:A8FQN9"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQN9"
FT                   /protein_id="ABV35162.1"
FT                   /translation="MRIKNQMLNQVSRKQQGFSLIELVIVIVILGLLAATAIPRFLNVT
FT                   DDAEDASLEGVTGGLATAVGFVRAQWEVDGRSNSSVVLDGTTLSLDTRFGYPTGMVTSG
FT                   SDTGNGNTSATAMTDASCQEVFKYVLQSAPKNVIYTADARKARYTFRVLDGSGGTAIAN
FT                   TGTTVTNLDLCVYHQVASLALNTSSGVPTPTLDLNKGNGIAYNAGTGTVVTFTNN"
     MRIKNQMLNQ VSRKQQGFSL IELVIVIVIL GLLAATAIPR FLNVTDDAED ASLEGVTGGL        60
     ATAVGFVRAQ WEVDGRSNSS VVLDGTTLSL DTRFGYPTGM VTSGSDTGNG NTSATAMTDA       120
     SCQEVFKYVL QSAPKNVIYT ADARKARYTF RVLDGSGGTA IANTGTTVTN LDLCVYHQVA       180
     SLALNTSSGV PTPTLDLNKG NGIAYNAGTG TVVTFTNN                               218
//

If you have problems or comments...

PBIL Back to PBIL home page