(data stored in ACNUC7421 zone)

EMBL: CP000821.PE55

CP000821.PE55        Location/Qualifiers
FT   CDS             complement(66124..66504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0055"
FT                   /product="flagellar protein FliS"
FT                   /note="KEGG: shw:Sputw3181_0486 flagellar protein FliS"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34668"
FT                   /db_xref="GOA:A8FP95"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP95"
FT                   /protein_id="ABV34668.1"
FT                   /translation="MLNEHDPFNAYKQTSLDARAAAANPHEMVRMLLDGLLDEIERASG
FT                   FMQRRSFEDKGKSINKCLNIVHGLGSMLDLENGGEVASGLNRLYDYCSRQLVTASVENN
FT                   TQALEPITKVISNVREGWANLN"
     MLNEHDPFNA YKQTSLDARA AAANPHEMVR MLLDGLLDEI ERASGFMQRR SFEDKGKSIN        60
     KCLNIVHGLG SMLDLENGGE VASGLNRLYD YCSRQLVTAS VENNTQALEP ITKVISNVRE       120
     GWANLN                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page