(data stored in ACNUC7421 zone)

EMBL: CP000821.PE550

CP000821.PE550       Location/Qualifiers
FT   CDS             671696..672217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0551"
FT                   /product="MSHA pilin protein MshA"
FT                   /note="KEGG: saz:Sama_0461 MSHA pilin protein MshA"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35163"
FT                   /db_xref="GOA:A8FQP0"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQP0"
FT                   /protein_id="ABV35163.1"
FT                   /translation="MKKQNGFTLIELVVVIIILGILAVTAAPKFINLQSDARVSALEGM
FT                   KASLQGANSLVYSKAAIAGDEKKAKGDWTGDNGVDIGTEDKAKTQYGYLQGLQVELENA
FT                   VDVKFNVGTSATDPKIKTDNKADWVIFVKSGVATIWQTDAPAACKFTYTESDGVGKTPS
FT                   FSDMPTASGC"
     MKKQNGFTLI ELVVVIIILG ILAVTAAPKF INLQSDARVS ALEGMKASLQ GANSLVYSKA        60
     AIAGDEKKAK GDWTGDNGVD IGTEDKAKTQ YGYLQGLQVE LENAVDVKFN VGTSATDPKI       120
     KTDNKADWVI FVKSGVATIW QTDAPAACKF TYTESDGVGK TPSFSDMPTA SGC              173
//

If you have problems or comments...

PBIL Back to PBIL home page