(data stored in ACNUC7421 zone)

EMBL: CP000821.PE551

CP000821.PE551       Location/Qualifiers
FT   CDS             672263..672742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0552"
FT                   /product="MSHA pilin protein MshA"
FT                   /note="KEGG: saz:Sama_0461 MSHA pilin protein MshA"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35164"
FT                   /db_xref="GOA:A8FQP1"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQP1"
FT                   /protein_id="ABV35164.1"
FT                   /translation="MNKQSGFTLIELVVVIIILGILAVTAAPKFINLQSDARVSTLQGM
FT                   KAAIQGANSLYYSKAAIGSHEKKDSVTVEGVLVSYGYLQATKANMVLALEIAESDWTID
FT                   DTTDRVAGVPPAKSTPGVITISQTDAPSTCTFTYTEADSASDTPSFSVMPDADKC"
     MNKQSGFTLI ELVVVIIILG ILAVTAAPKF INLQSDARVS TLQGMKAAIQ GANSLYYSKA        60
     AIGSHEKKDS VTVEGVLVSY GYLQATKANM VLALEIAESD WTIDDTTDRV AGVPPAKSTP       120
     GVITISQTDA PSTCTFTYTE ADSASDTPSF SVMPDADKC                              159
//

If you have problems or comments...

PBIL Back to PBIL home page