(data stored in ACNUC7421 zone)

EMBL: CP000821.PE552

CP000821.PE552       Location/Qualifiers
FT   CDS             672951..673418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0553"
FT                   /product="MSHA pilin protein MshC"
FT                   /note="KEGG: shw:Sputw3181_3603 MSHA pilin protein MshC"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35165"
FT                   /db_xref="GOA:A8FQP2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQP2"
FT                   /protein_id="ABV35165.1"
FT                   /translation="MRTVLPQSGFTLVELVTTIILIAILSVVVLPRLMTSSSYSAFTLR
FT                   DEFVSELRKAQLLAMNNGDYCYRIAVDTTGYQLQGFDNTGCTGTAKLTETKQTFEGRAS
FT                   LELDSDSSKSFKVNFDRQGIASLGCSGACIKVIADETLTISIESQGYIHGR"
     MRTVLPQSGF TLVELVTTII LIAILSVVVL PRLMTSSSYS AFTLRDEFVS ELRKAQLLAM        60
     NNGDYCYRIA VDTTGYQLQG FDNTGCTGTA KLTETKQTFE GRASLELDSD SSKSFKVNFD       120
     RQGIASLGCS GACIKVIADE TLTISIESQG YIHGR                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page