(data stored in ACNUC7421 zone)

EMBL: CP000821.PE553

CP000821.PE553       Location/Qualifiers
FT   CDS             673408..674004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0554"
FT                   /product="methylation site containing protein"
FT                   /note="KEGG: slo:Shew_0399 methylation site containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35166"
FT                   /db_xref="GOA:A8FQP3"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQP3"
FT                   /protein_id="ABV35166.1"
FT                   /translation="MAVNSLSITKRTGALVITKGFTLVELVVGMVVLSIALVMLTSMLF
FT                   PQADRAAETLHRVRSAELAHSVMNEIWGKRYDQNTNPNGGVPACGAAARPDLGLPAGLA
FT                   CTAPGALGPDTGENRNSYNDVDDYHGLNQNSLMLNAAVTTGVNADTYASRYPNYLLAVA
FT                   VTYPDTSDLNRKLITVTVTTPSGEQIVYNAVRSNY"
     MAVNSLSITK RTGALVITKG FTLVELVVGM VVLSIALVML TSMLFPQADR AAETLHRVRS        60
     AELAHSVMNE IWGKRYDQNT NPNGGVPACG AAARPDLGLP AGLACTAPGA LGPDTGENRN       120
     SYNDVDDYHG LNQNSLMLNA AVTTGVNADT YASRYPNYLL AVAVTYPDTS DLNRKLITVT       180
     VTTPSGEQIV YNAVRSNY                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page