(data stored in ACNUC7421 zone)

EMBL: CP000821.PE554

CP000821.PE554       Location/Qualifiers
FT   CDS             674004..674813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0555"
FT                   /product="methylation site containing protein"
FT                   /note="KEGG: slo:Shew_0400 methylation site containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35167"
FT                   /db_xref="GOA:A8FQP4"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQP4"
FT                   /protein_id="ABV35167.1"
FT                   /translation="MSGLRQLRKSDGFTLVEMVMVIIILGILVLGVSSFVIIGTRIFVE
FT                   STSVDQVLSQSRFAIERMTREIRNAVPNSLRVTNTATYQCMEFMPIQGSASYIDLPIAP
FT                   EAASETGSIITPSQGINNTHRMLVYPLTPAHIYEADPTSSEGRLLDIEKVEGNTVTFDR
FT                   AVRISEASPRNRYFMVNNAVSYCFFTNGDVRRYEGYSMFNTAQPAPADMGDGVLMAEGV
FT                   VTGTGTWPINYTPGSLTNNAVVQLTPTFMVNGQEFQYQHQVQVVNVP"
     MSGLRQLRKS DGFTLVEMVM VIIILGILVL GVSSFVIIGT RIFVESTSVD QVLSQSRFAI        60
     ERMTREIRNA VPNSLRVTNT ATYQCMEFMP IQGSASYIDL PIAPEAASET GSIITPSQGI       120
     NNTHRMLVYP LTPAHIYEAD PTSSEGRLLD IEKVEGNTVT FDRAVRISEA SPRNRYFMVN       180
     NAVSYCFFTN GDVRRYEGYS MFNTAQPAPA DMGDGVLMAE GVVTGTGTWP INYTPGSLTN       240
     NAVVQLTPTF MVNGQEFQYQ HQVQVVNVP                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page