(data stored in ACNUC7421 zone)

EMBL: CP000821.PE555

CP000821.PE555       Location/Qualifiers
FT   CDS             674803..675288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0556"
FT                   /product="MSHA biogenesis protein MshP"
FT                   /note="KEGG: sfr:Sfri_3740 MSHA biogenesis protein MshP"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35168"
FT                   /db_xref="GOA:A8FQP5"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQP5"
FT                   /protein_id="ABV35168.1"
FT                   /translation="MSPNMSHRANRPFRGFSHCRAKQQGSALVIGIFVITVMFLMSAAL
FT                   INVLEDADEQVSLEVWGTRALFAANSGADRALAQLFPLTATDASAASCTNVKEWKNLPS
FT                   VPGFHGCSVVLTCVTNTVDSVNSYRITSTATCETGNCSGNDSSCLRVNRQVEVEARD"
     MSPNMSHRAN RPFRGFSHCR AKQQGSALVI GIFVITVMFL MSAALINVLE DADEQVSLEV        60
     WGTRALFAAN SGADRALAQL FPLTATDASA ASCTNVKEWK NLPSVPGFHG CSVVLTCVTN       120
     TVDSVNSYRI TSTATCETGN CSGNDSSCLR VNRQVEVEAR D                           161
//

If you have problems or comments...

PBIL Back to PBIL home page